Zu "GeneID 117158" wurden 8 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Secretoglobin family 3A member 2 (Scgb3a2), mouse,...
Artikelnummer: CSB-YP846028MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 22-139aa. Protein Length: Full Length of Mature Protein of Isoform C. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: LLINRLPVVD KLPVPLDDII PSFDPLKMLL KTLGISVEHL VTGLKKCVDE LGPEASEAVK KLLVIIICSY FPGRSLCYVN NLPSFVSVLF LPMICAYPRD SKKQTFAFIE...
| Schlagworte: | Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2,... |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | mouse |
| MW: | 15.2 kD |
ab 336,00 €
Secretoglobin family 3A member 2 (Scgb3a2), mouse,...
Artikelnummer: CSB-EP846028MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 22-139aa. Protein Length: Full Length of Mature Protein of Isoform C. Tag Info: N-terminal 6xHis-GST-tagged. Target Protein Sequence: LLINRLPVVD KLPVPLDDII PSFDPLKMLL KTLGISVEHL VTGLKKCVDE LGPEASEAVK KLLVIIICSY FPGRSLCYVN NLPSFVSVLF LPMICAYPRD...
| Schlagworte: | Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2,... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 43.2 kD |
ab 283,00 €
NEU
Mouse Secretoglobin family 3A member 2 (SCGB3A2) ELISA kit
Artikelnummer: CSB-EL020819MO.48
Sample Types: serum, plasma, tissue homogenates, cell lysates Detection Range: 9.4 pg/mL-600 pg/mL Sensitivity: 2.35 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Secreted cytokine-like protein. Binds to the scavenger...
| Schlagworte: | Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2 |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | mouse |
ab 603,00 €
NEU
SCGB3A2 Protein, Mouse, Recombinant (GST & His)
Artikelnummer: TGM-TMPH-02891-100ug
Description: SCGB3A2 Protein, Mouse, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 43.2 kDa and the accession number is Q920H1.
| Schlagworte: | Scgb3a2, Uteroglobin-related protein 1, Secretoglobin family 3A member 2, Pneumo secretory protein 1 |
| MW: | 43.2 kD |
ab 278,00 €
Scgb3A2, Mouse secretoglobin, family 3A, member 2, Real...
Artikelnummer: VMPS-5698
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2 |
| Anwendung: | RNA quantification |
43,00 €
Anti-Scgb3a2
Artikelnummer: G-PACO39234.50
Scgb3a2 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse and for use in ELISA applications. Scgb3a2 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Secreted cytokine-like protein. Binds to the scavenger receptor MARCO. Can also bind to...
| Schlagworte: | Anti-Pnsp1, Anti-PnSP-1, Anti-Scgb3a2, Anti-Pneumo secretory protein 1, Anti-Uteroglobin-related protein 1,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
363,00 €
Scgb3a2, Recombinant, Mouse, aa22-139, His-GST-Tag...
Artikelnummer: 375219.100
Enzyme and pathway databases. Source: Recombinant protein corresponding to aa22-139 from mouse Scgb3a2, fused to His-GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.2kD, AA Sequence:...
| Schlagworte: | Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2 |
| MW: | 43,2 |
ab 575,00 €
Scgb3a2, Recombinant, Mouse, aa22-139, His-Tag...
Artikelnummer: 375220.100
Source:, Recombinant protein corresponding to aa22-139 from mouse Scgb3a2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.2kD, AA Sequence: LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL, Storage and Stability: May be...
| Schlagworte: | Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2 |
| MW: | 15,2 |
ab 621,00 €